PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_019956-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 166aa    MW: 19084.1 Da    PI: 10.8965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_019956-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.12.4e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++ Ed +l  +++++G g W+  +++ g++R++k+c++rw++yl
    NNU_019956-RA 14 RGSWSAIEDMILTSYINLHGEGKWRELPKRAGLKRCGKSCRLRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding51.32.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ +++E++l+++++++lG++ W++Ia +++ gRt++++k++w++
    NNU_019956-RA  67 RGNISKDEEDLIIKLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNT 110
                      7899******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.794961IPR017930Myb domain
SuperFamilySSF466891.22E-2712108IPR009057Homeodomain-like
SMARTSM007173.8E-121363IPR001005SANT/Myb domain
PfamPF002495.6E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-221568IPR009057Homeodomain-like
CDDcd001671.71E-81661No hitNo description
PROSITE profilePS5129425.78362116IPR017930Myb domain
SMARTSM007171.9E-1566114IPR001005SANT/Myb domain
PfamPF002491.0E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-2469116IPR009057Homeodomain-like
CDDcd001671.16E-1071112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MGRRPCCVEE GLNRGSWSAI EDMILTSYIN LHGEGKWREL PKRAGLKRCG KSCRLRWLNY  60
LRPDIKRGNI SKDEEDLIIK LHRLLGNRWS LIAGRLPGRT DNEIKNYWNT KLSKKIQGQT  120
PKIRINGSVE KKAASESFVS SETPPVIKRK PRDALGFFSH GKKETR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010276720.11e-119PREDICTED: anthocyanin regulatory C1 protein-like
SwissprotP102904e-63MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBLB9HD163e-71B9HD16_POPTR; Uncharacterized protein
TrEMBLC5HYE63e-71C5HYE6_POPTM; MYB transcription factor R2R3-like protein
STRINGPOPTR_0006s23840.18e-71(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.12e-60myb domain protein 111